ZX`` @0 C0T7QT" 3 R @$( U|R I``` ```@``ﾭ (OР iHMP  H4P OР iHM  H4P OР iHM! H4P HOР iHMp! H4P OР iHM! H4P uOР iHM0" H4P shOР iHM" H4P P)/@-y~otР9Р9CHРP L8((0 S%?C?C 8 ȬdTea8/*/0Od@P TP  Q:< 80QR:/Te- $M<0 @DH 0! 0 0 F$Ѝ/s@-0`40P@0P  PlL`0T\\zF u us0S  008 T6/ЍpcccKd#c//p@-Pٟ R PZ 0A800P0P  10  ` R R P! 0 '0 100 0< @0D H  Q R ````0 B 10` 000 p@Q R $wd~0 6/P0  6/P0+ `ZU z z`d( d[dhdsd/ dV'9d39d dDd&da dK9d| d d8dd d ddPdtddddddM-PM@ v`PB   U-0Q0Q P/ PP?L!6pP(RPP; `!00!0=P. ЍpQ=pGorpW p HPZ   0 ЍMXfQ   4~Q$gQwddddcdddPdA-`Q@PBp@lpV PA-x@pPP T` 0 @8Y4/$ЗP F/ d dwd PE-#P"0`Sp V$@V@DS 0 @P`(X 0 5/ Ѝ0  0S 呗 @P@Z dKdwd P0@-MP`@ 0(P 0 Ѝ0y 0 r/=dp@-P`@PIp03/ d P@-@4// d//A-@`pP0` 6/ TP@0/|c0 R R/00 R >dA-p0"M/S@P 0S00,`` Vp #"ލH~D _P0 5/PW005d5d=ds@-@P`5P  P 0Ѝp@-@Q QQQQQ Q$Q@QM-pP@0S R R`J=RPPV 0000X0     JcA-@0P0 Q Q ^#Q 0S S^0 Q  Q 0 000ЍR0 0 0p`熁Q P00 `cs@- P `@P00  AЍpNd@-` pP@T < A ЍP 'QGNdQ@-MlЍ@ L P 0 0000000 0Z 3d~d)3dM-#MMP 6@ $h408Pd >d>d$>dKd->dS>d_>d>dz>d>d>dC=dMddH=dd>d>d>d>d>d@-0@P0  çЍM-P`(p@P` AЍP @P(0 (ЍMK6dh6dM-8MPX0S ڔp8Ѝ  0`@a40S S S 0 Ae X0 0 00 Pp pD`[O@PH D yP A|9p <00<@ 0 (`,0S񟗈l6`8`8`6`8`8`8`h7`h7`7`,8`8`8`8`8`L8``8`t8`8`8`8`8` 0`40S S0S pP p{1A AT %pPj< `P 3NP 00[pP ` @N W>0Sp0S 0S ~$0Sz$0400(080m` @$0S.8`9`9`45`9`5`5`9`9`9`9`9`(9`5`d9`9`9`9`(9`@Tp P M@W X0000   $ Ap^Nd}NdNddNdNdp@-@MPM`Pp@M<@`s@-P`QN@P  00000 0P@ЍpM- 0!(M 0P@10@@@a 0H`P\ |匒p  W"0S T@DZ;$?G@HT>$P; @[8 0S<Dw@UЍ 0   1 0U0C?o20S  #P S 0!,,!  ##4<*B@A4ЍA9dp9d9d9d9d9d9d9d:d9d:d):d@-a0/0d@-hP@R*ddp@-_P  p0@Pd`P0@  j`w H0W ,@0,@D, 0R aP  ZP a aPH000@ 2$ $aP 0000cc*dcA-0d@-8pMW`@IPP @ 00 0 0契@P xFЍ!TW0@@(04PA- MX8Pp@` ]>PtP0 R0-P 0 00 kP00 Ѝ@-]@-]000p@-]@-F+FPPp@@-] 0Pc7@-Pb@P] Ѝ07@-P@P Ѝ0@P0/E-M a 0S Pa`V  0p0CC1"c$(ࠀBT ЍT  0_P 0S `Dp s000PP  n]P 0dLd0dr d^ df d/p@-HM@P ,l,04`00D 0,0P @l P HЍpP Z`s@-P @`[! @ 0Ѝp@-,\00hd@-@aP0S 0S G`VP \`U p p D0PU 0S ЍP  d@-@CC@C/d/dM-p0M@៨PPP U l!ԫPPP!0Ѝ 0 `P0 0$00 0yP aC000 `P(00 0ϲ`P#ٱP ᡲ, ( B ` $`P0IP01C, 0`PứYcc9cicmcM-0S{ `+pP vЍ0J0孉P+ p0 VHBS* PP\ꍺPP 0-?  8  ደP B88P0 1010  Q :S0! 00*TP Z 0!010RPU WpP$<$(<0$$,000L-?  P0P@ccc cdcc| d7cA-$p(`X @,P<D0SS "0SPL0 s0SE @$ᄧP 0#,,#4 <0 Ri PXP @P PP LB|kpABP` PP L5B0S <Ѝ0S$@:PT  0"\\"$P,PUT #,,#4 < 0S00T0#S@x p@0#,,#4 <00ccccTctca dcc| dcccc,cc/@-`@p@.PT.P@P8E?P$HPU 100!0-/W !,4,8!  }/PP0S 0S "<<0"00W ៸ .PP  Ѝ Q:dp:d:d:d:dd0/Rp@-@@`P0vA F@P@pDdldE-BXMP`0@p00S:S#SQ  GP 0 S SlSЍ\0 0 G0RP000000 0جdd0 d@-@ᭇ@F d@-@(xP@0#,,#4 <0h SdPP@q<@P, (@8dY9d9dV'9d09da dH9d| dRD0A-Pp`@T@P`U0ds@-@PӇP ,0`$` 0 RЍp0dd@-,, L0 L @G Ѝ0dldm۶ldR@-FKd-M Ǵ@@Ѝ&d'dM-@P`SXp> )X\t帻Pt   0@( 0 )T2"TP qTX ᘻP6@mSP@[ ㆻP6SЍl {P DSP LA< kP RP  0 [P@RP  >P   { w0@p 0 S 0 TP 8\d?cdcoc.dcccvdc"cccc@- 0 @FЍԭdp@-M`@APP V0  -R̿PЍp@ @<@ pTB|@BP 8崿P|0S@@@5 d! dA-`0BSpP@T EP 0 DRU(0^0pA/ԭd8ap@-@ePP10#,,#4 <0 SP U P| 0Sp @0@#$(#4<@(?p Rp@E( dV':d;d;d ;d0;d>;dR@-E㠿@1@{"d0 'c@-  Ѝc@-@|8M@P`U pPX< L0@ @0U` @0pSP 8L  ׹ [ P پSԾlptl R  l { e$d徾(Ѝ d d d d d d d d d d d& d5 dG d dO d=dZ dl du d} d dRA-@PD`B pDP 0 A//ddR p@-@ؾ PӾ@bV up/ac-$M iV00 00d$ЍcM-C될P4>@TЍH lI0.0O.@DIH`HpHD  R ?Vp 1>@ddd:ed 0 B0 S 000C P 2#0//@-@.PapiW` 0@0FS`FP00 P Ѝp V5P  P 0d2#0P` V`PV0  S 0P0S0PP0;S0 V 0< ?bcP0d 6#`VQ0@-dQd=dXd>d^dddmdtdddPdd>dJddRㆼ/@-O Ѝ@-a Ѝ@-! Ѝ@-U Ѝ@- Ѝ@-1 Ѝ@-C Ѝ@- ЍRp@-`Ml`Ѝp@00  08IPP  `;P 0 ʻ'dRd0Q/  RR Rd /P/ R @ RPRP /QPJcM-Pt@P `P @i;)P3 X i ˺HЍ赟P" C`&P``V X巺Do0S@: 8 ۵P<W)P W@0 "<<"$0,0  P Ǥ 兺 ,, ,0 ,Ġ Q*L q9@4 㘵PWA @P  ᲧP  }@PW& ȣPW@l 0C  Rt Q d 0000 <RpG6000<P>QN W Q@!   0i 0?R    ,,   0    BRʌ q    Q [R0T100D[L; ]R  R R@!   D0]Q00 : ᷦPZ >. :  W 0@Pᩴ 0  W  0gS0W0~W0sSx   @P3n[ Ws[4? p峟0nS@P0 RS PnR U - 0哟 0@P0sS U0Y R@ PRH0vS>W  㖹`vPPV0#,,#4 < l [ uPKPp@VyP0VS x 0 PVaS  sS=tl@C@lS W㘧 W @@ nPPT9 0 PP <ڸj00U00S ϸQ (ȸX ᇠX P& 6Q A൸@TڰY@DXP a0@SJ`d```ĉ`ĉ`ĉ`ĉ``HPAT tP! 0P#$(#4<!<< !0PsXAlXAeQ x^TlAYX\T びPϡPW B@Pꤥ@Py~0hSW00gSd@LP @ T~1 #$(#4<{~0d#L$L(#4@<@0#$(#4<00#,,#4<  00#$(#4<0 0#$(#4<ܷ00#$(#4<зdͷ0\0#$(#4<T'0(0#$(#4<᳷T 0 0#$(#4<᥷T 0$0#$(#4<ᗷ8咷 㾲P  <$<( 0 00@ 㫲@P + p % 0 %O 㔲P00pSqPXVX0 Ở@P0000 0@aSY  @p0 ~@Pin"dd}dYdddddodrddddzddDd3ddJcNdhdKddFddddd8ddOdddddddddddddd4dcPd_dvddddddd d$d;ddWndd?dZddddgd%xdDddS Ho@PiHL P@G@WP0@ ,PPE# $#I PW $;X 0l000S0@6dRp@-P`< ı@P  0p@7 d6*LpdHddRaRM-phMP`EU@ 0 CPP0 @00 0 00^0 J P  ThЍP)P$  ,, 48 ,,Ġ ? 0 @ I P00@B5/ dMdded0d@- @*R|T T T nTA00*Sa$S/0{S  /S 0}S00`|M-Pp`-lAh PK"XGVP! @U?0`<`l`H`X`h`oPPP @U괔`Ĕ`Д````DoTTTTT@ TჵccR@-@=P0Pp0 4H5P o/d0 0 0 /|dldtd,0 (0 $0 0 0 0 /hddd|dxdtdpd,0 (0 $0 0 0 0 /ddhdxd|dpdtd@-r5P @4p@-AM` a?@PP@ @`Aލp@P ? P\P @ @@ @] U{@dh`@d d 00S/ 0/|dtd$ 0S<#?/d80p@-4P@T(@Pp44@DdddM-?Ml ppС`Pzı@[^ 4 R 4 PT QP] P[ | p!Q 4P QPP @0 @| P  ᅴ >@P0Spd~Q.l4 !0U0C0P!V`1@@DͰ0 |@[hz P HR0 T=P?ލ dlja?d'@d dp@-@Pz0P1@oU@ 㵴@l%bd@Pe4P 3ㇰ@Tu0p 0Pp`d dkddd0dM-$`@}zPU gPV `VP\pP pZ P3pfK3 P`P  tӳpPX6X`ɳ@Z @ó$-3f(3PЍخ @P 孳pPe5@塳5%P5 5% 5 5# 55 5*4005% T3P P@M3`b I3_ @ 0D 00S0+*=3S `@ `F0S@`C13F -3`B )3? ` @@,"/? 0 S4 K `F `_ k&@t0030" DX@`F= R1 $`@Q  0?S@2/00V2 <#O?@ @P2 P) 00#000@ 00N00@(t3@00 -x`30S0 8303/SX<0 8R010 0SX b p00Ÿ02#0 S0C0Ÿ0 0CS@I~S@D !S@? l @S @5 `@\ ?\@,ŸS@@& ŸS@ @- S# @  NS @  1S @ S @  "0 0 00@~00000 00Y00 @0 0q00#00@Y00 @00@ BX1@00@Dd`2P )2®`VTl0  Fxu >0@PqhddPdd0dBd5dgdmdddld`ddx`ddddhdLdPddddcdtdd@d ddRM-,`0尰尠@0Pp 0x:@P mp X P ep0 ަ0PPp@ЍddddR@-$@G رddR@-0 B0 0 6 Ѝ^dA-`0BS,p&P"W@ Pt孱p-``T``T H報٭` !dﾭ$"dR>p@-`9PP9@P U0U0U00U0 R  BU0 R  BU0 R  B0S  /pRE-@M4`9@P<0DS qpܠ0P嚱0 啱` HP @ T0S PBP @l0P@X ЍT T00 `@Pcddd+dM-@Pp `]9PP+ R10@|U`Ed۰`\0PW @P< -RW `e z R@`ЍUW@崰UW@᫰`UW@|ᡰ`W \`ᘰUP哰@0`፰U,$dddFdFd6Fd5e$Fd0Fd*FdR }/R v/A-p0BS,8PP(˰0 @ X` 㽰0P:U``r U @` UP`*dR M-@8`P喰\P吰Pp 勰 P,/ /dMd7@-P@v0 -Rl Ѝ0p@-P @Q(0 Up@ H'dW'dO'dRM-XME@`7P 0=0P7`060D7< 0708708007090(703 7p0<0P0ӅU= 7 6U 9 8U U8#80700S <ѪP t坯 XЍ8<0iS4U6@`,v,`@TZ;00:0@ *P@ :0$ 0;DPPkş 0$ ,P  ]@@rS6@' wSa6@Xe08PSS*!03>0 P0  >PP 90R`S`S* /@@08pS!*|4< =  l46 d4 \48 T49 L4# D4 t` X  HP P  PP9 3R*@@mS16@sc08PS#*04@0 LP4 0# 0 4PP ̮ɮTƮPP90S*@@( <P8 Z90$0 S宮60(00S{:R@` @0 P  ᗮ0(0`@$0 R(0SD剮0Tb0$Z  Q 3Rp X 0C0AS 0 r0 0 0R:j1`SP 0R"P0! XW 0%R $3@P!0 | Px! p A? 00R 908T301,/WT2R,0',0S SWR H <APqU&ddddddd6ddd/dddhddh d dOdI db d d d d> d d d\c !dcJ!d[hdldd]!dudpd!dzddds@-`@ PfQЍp 0-R  R  S00 R RM-P0`M`5p0(0 50,0508040<0400040404004@`P00xSP 80(0,00@S ( RwV $0SrV0XV-`Ѝ0rVpH0 wV(W حHp8#80W= .ṨP, J @W`0< 08@ 0KrP4 0kPpGW 0GSW@P , (YPlV+0<080sP @80,0(0T, (?P80 0S4p0SZ00 00;/PP 0S0 ( 0 ;/Po 0PU 0S0  I[Pa 0PUP$p۬$p0SP80Ҭ P0S.pZ,0 ;/0S   ZP T巬/0 $0 U(᪬ ("(ᥬ 0SP/Tr P(0$0,0080 0<00000rV40 0 wV t0$ `L0 H0 @0 80 00 (0 0 8ddddddddedddddddp@-`@ᗨV)P?.哧0P d 0QR`P :p0A ^1#!0,Pd㛨ppA-B`pBP< 0 S:$+@TP@@:FdUFdM-@M0P8HP  0h`@dp,@D 0, 0RЍH "T,00H 00~,@,@D~d!dKd!dR/@-@<0P APb^脃e!d!dE-@2Mp `Pq P ᳫ1UT Ud UPlq+偸PPa1P   1P ׹t  l0S ` \0S P L1P ¹8 w 01P ṹ n 1P ᰹ e 0S _ U! ЍE WP70PS\0 0+0E00+00PЍvevehd0d,dze>dze >dWeddWe[Jdze=dze=dzedJd XejJd]ZWT7@-P0V<0s800Sk 800Sg !J!00P00H00< @0_0PWH @! LDR 0U ㌤PS `QO $ $1/PINoP jP eP!V8&0@ 1000P00 H08P @<0+S@pp<0T` 0SW 1S C 0c`$ Q [(PHP@`:Zt40Ӛ?2c  00-0P0s* (88 @, 0(00p$0,(0S00[0SX* ([ $ J@Ȩ  P3 0 庨@@T@A(0C,@D T @!dP Gy0, G, d`垨٤,!4 04 FAIP㨲 0  [P$00$0p`!9IP`1T0   0!"IP 㒣P ㌣P H @0 IH@ 1@ {P _H @0HH@ 1@<T 7|4x`Q ؤ1/P 0@ H@ @@!T,b(>PV H2P{ P,@Pu +P &@PH XQPU \Q 0T 05/@P50@1/^"dd"d@B"d\dN#dc#d"d"#dQ"d#d#dMb#dk#d"d"d#d#d| d $d&$d.$dR$d+dm$d//RM-`BPp@䲟00S P0Ԣ0"P" 0[@oЍ C R񟗄` `4`D`T`h`````P`|``ݢOoBWOoBX{ @@@0pp΢@P@垢嚢喢O呢P@@  @@DOoB  @ߧ@T@ ا @ӧT@@ ˧ @ƧT@@Ө 徧 @幧T 峧 @宧T@@0Nu@S S Spg0 `V Qg MXZT@@c P0 Pd```````````T/P SL/D/@/</8/4/0/ /$/͠dKdd۠dddddd+dPp@-P@ P P p@徦U U 嶦T T Tp@諦PE⨦U``````坦囦Tx PTp Td`\XTP ͠d`'d#dYdDdJdSd?dbdqdnddϞddvddddd1S/E-@Q!gl0#4(Hp ^᫡P# 0 U1S$ P!|J0! S0#!BC/0BO #4 X8 Ѝ სPP!)(ޟdddOd2dYddE-@MPi`, @p, @>P, *@ PB,9v@tPC , @VX0  C` W 0|  `00!00CS ! !p(H`!10ۥ(P 0 `ѥΥ, ? PЍ5@P p?徥 PPD0 ?@ @P @P 00 ?_'ddFd4/Q/@-M@@< SP aލ芠dM-PY1@!  10010J1S pE`@@1SDЍM744 !(0$.#!"!Z($1S #$䰟J`%1 S@*0   +10S S S0+10S.h, ` p ddٞdKd dddOd>dRd~ddddddd}dddϟd@-@dv, >PЍD0 9?P 5?P >>7@-P v\AP0@ Ѝ0D0,@0,@D, 0R>0S >P D0>=0S Ꞗd@-GcP04d`R/p@-`MP @᤟P @30S4lЍp  㔟P `a ㊟PU $Ra20S|  wP$ mPU塤@p0p@P`w L SPoUӳ剤P\`P } 9PP0SSESF0C S$`l`l`l`t``l`l`l`l``l`l``f0C  Rtp@U* \0h #0TdX%X $ &p ͣʣ@ƣ@£@徣@庣0h 0겣E ݞPЍp@t |0Ѝp@ dTd$dhd$dV"d$d$d$dl`d$dc`%d%dwd;%dV%d%d%dT&d&d&d%d%d%d%dv&d&d4dM-`(2$p@cjW.W@( ڣWP# ԣ`Pk _0#,,#4 <0!SPtLЍP`00SH20[0W0S()Z 3P  ,U%*0 W }izi[ [  Ǟd"l 0zP L"0d( d'ddV'9d39d dda dK9d| ddd d8dHd`d~dA-pQ` -R p @0h0P0`FV fSp 0SA 0 ᲔPPPdDd@-kPRA-@PD`B p(P 0 A//d0@-0,MPP 0 0 0 (0P  [@T \倢@,Ѝ0@0 PPP妔@PK"#l@Ddk+dr+dRA-@P0 -R0aS@DP tp`V@ TP @ @G@P<p` ddM- M0 ` 0 P HX= @ -RF S4 [ZXpG 7PB xX@eUPQ T\ @Dpz `0PY ! ЍdR bR cR rR tRSN0 SI0 R@S@0P`U@ 0 R0S @Tἡ@ ᷡX`&0 0 0 P@脔Px0x奡U`&0PC0 0U`&000(ddJdhddd"dDd0P040 RV p P0 0S0S00H p00ZU0  *d1pw0P!pCpp0 o=04p 0S0`0 0S ߔ ܔ40p0S Ԕ0Z L000; P p庙;0<0P AK"Sr0$0 @ $ `Q4dfxd0d^P  Ih28P`2^ 0@Pl0)8P @^4!8P (^ 0Ppc dcccc@dM-`P0Pu MWuU兗@P$ RYM s㷓@P FP@p0$U00S _Tϓ នP:PEp@d@ccc'ic//00C@0/`Te80>080/ 0 @8  B8 8 . 8 8 H /H05C:C0H0//@-0  80 6CL0P坾 00  p R @-pll00#,Ġ ,#4 < ᅾp l / @-c@-  @]=d////////////////Q @-H L B H H L /l0S l0!<<!0000t0tH00C0H0H0tp0/H00C0H0H0P0////M- @ HP<P!@໊<0\ \ 81 3 #S41 B2s2 Bs0B0Q0CL0C?B!c 0 B~ `b0vp07 P T!00U U813 #S41L2s2Ls᠑ࠁ0L 0^0C0C?L1c  C `c╬1t' 1p7 Q 0 RP 02, Y !KdgfffYdd4// p@-0 0PlP4P@ @44 8 p@H00C0H0劾 00rp@-HP  `0Sp@@L@3/0P  B딋cc///0<00/0 0C0/`LieDd@-@- )=dD@-G6P h]0@l,,\  \\=d0d>dhd@- ;2$峕寕孕 Ѝ d dOdT X Th2@-8@ @@@-霻/////////@-0DP80`0S @@L@3/0P   Bn 눺dc@-@P` PU*P0S*0P * S@(: PSP#* S t.̠̌x.`Pt&x&dl`t&<NP_p c@P,  P@pWȰ@|壋 x< S   S   S  , @0qI@P dtЍdM-P M, $@P `` P5Pp W p ,P  040#40 ⢲  ➲0 01S 0 0  S 000 90 t1S P0<0`0@S{ pSs SP4n 0h d000 00` tPH&00?, `P,90p80Y pp` 9VrQP ᏋWp1;`dWd 9Vc`s` 9VcP0S0043@T 0 0C#0 0S 0Pt:?0` PV 0Pf:0 0 0\`S2@01S22p`P 8`1SV0hhd00&h0 000 0`P ݍ` <`{P儊 PP0  p0` 0Რ0 000嬆 0P:   00 0@ 0z  3  1S *o  !00SP ]0  g  q   R 4!U004ddXdh dd@-o#@9 R  /@-@M0h}?00 00  0 !0HP09hW 0h0R8K 0h0G @ЍIp@-(MP@ 0h10P}?0 0P 00 0P!0 \ 0h0@` 0h0(Ѝp`M- 0@Ph!0M!0R3D 0G@A@0`04 0G@AdpWM h   2 0 0 W00}?0,00 0$ $ `9S< 1 0 09,0Z`09 00S0 0h}?0c0 000!0 `PI 0h0I0Ѝ,0Z [0K ,0Z 0pWޝd0@-000@%00 $0` Zp_0S nPU0S hP 0S 0SS P` Ѝ1S S 'ܥdM-M'`@P`p 9 0Sip 1#4,01-01SPB [ 09,03/Ѝ 0S/ 00b02000d0 0h0c 0S[09 "0S"R W "-  , 0SSS S X -  , 8 n$ք  pP8ddp@-\@P h`垯00b0200d00 0h0 0c0003/h`pdM-R MS `p@o "!HAYEME0 b h`S'< U X!'(%X!000(%4",00 0400 h`d X000* 00 0b 00 0"c0 t0 P2/P    00S 0 H EE Ѝd Zp`dM-R MS `p@ C"4!HADD0 b h`S'< U X!'(%X!000(%4",00 0400 h`d 000( 00 0b 00 0"c0 t0 P2/P    4 00S 0 HDD Ѝd Zp`d@- h}?Č00 00 0ЍM-<"0M⣁c 0RX@'0 pwh0to``p1000d003 0b0 0 PǮ}?0q 00 0P4X0/\埃 `0gh d0P0d0`aS ` X}/ P  h eP 9 X  Pp} 00 0 Op' 9 wpPP T0R0 0CS 0SdP Q03Ѝޝd`dUSBCUSBSs@-tT`PPU<͆ЍpP@ĆƦdԦd0 /\dP@-(峆$@$密P`d\d2dA-XD`&P!1pS="10CS9@8 حpP"1 0#1 0S%PS&!1Q!,000 !R  5P 0S 0S 0S 0S 0ASc ! 1]Ѝ+! R*   +! R*!  .!% 0  Q %0S0%00 h0 \0$9CP0 S4181#81:03I`MaCadGaCaNdBaM-MCgh0 0` 0P b0 M00b0c20$00d0003/pP Xp"0S,0:S TTZ&-0, "< 0S Ѝ2 320  0J EFȱ  ZA 0$0U0^0  b0 20 0d c0 00 3/P0'p0p0 ?P 0W00 S : 1! QP5  P P4 P000hS!S 8}0|(0S0S0l(0000T8  (Ѝ;0@0 0X~ P :U\|aa`a$`a`a aaPaaOP[P !=10@SK`a`a`a`adaadaa`a`adaadaadaadaadaadaadaadaa(da|dababadaacadaaba!0[S0(00PC0P ~P"010CS baaabacaaaaabaca"02S #00@S$ͅ ;0@0 PU*PY~P %"(00CP0@S babagabacabaea badeaea`caeaea daca daeaeaeaeacaeaeacaeaeaba0SQ 0APK00  0}. 0 2 '%UPEK0P 0PEPPUP0U* PPPU PEPQ*PEU 0  0} 0  [*PyPUu*$A00CU0:iPQ 0E0c*4ف(PEPPUQT #Ɂ00CS0IP3 R BqQ3 Q2`#0SLS 800S000Q #QU [Q||PP  RKt"xm00CS0P U:00|0 PP 000C 00;0 0@P0 |"P p W Wfa|fa|faga|fa|fa|fa|faga|fafa|fa|fafaW8 WD W- 1 RO WD00d 0 PPP 0@0 000 0p0000 0E!00 00C 0 0S0P00 k0SP0 S0 ]P 00 00p0@d5e5ed5eX5eDddKd4dc,d5e+d8d t5eM-M@Pp|0$ PUPUiPDh\QS`@'V \KPE`/\V \ [@N `\S S# \Q'V00S0'`$VQPE`( 0 {V(V000 U `@PPE@ p}V)V 0H C Q S0;0CF$ P@0ppPE00S U00ۍ040/:ep@-$P@<03/P p@@0/:eP/0 230Y/ R/0 73080S//:e0Y/ R/0/0Y/ R/0 000/3:e(0S @-3//p@-PQ P@Pph0TQ Tp| P | H| @|08  p| ,|0$  pp:ekajaja(kcljadp@-r@P00ST U  P`@@ZT000pHU  R/o"HPC H@CUT d:ep@-P`P@P `000S$00S:Ppp9e9e9e 9e9e9ep@-`0PPN@@DN@JD T00Pdp 0@SH00@8p0$ PEPP00C0pdd9eP/0@- Ÿ 0@@PUQ 0C   010S010@Q P0C P P PQ DP00  0 Q 0 R*    A 1 00 R"182:Q[ TQ"nUQwxQ"|~^  A@! 0^ Q d d9edT5%0 0/P 0SM-U`~V*  BP1 R00 0 00    8`4?0 S&380S[0 TS&6n0US7w0$S&9|0~0 !BP   B\0C0P3 N\00 0  0\ 0 00\000 ^*!B L  C\ :0.0 Ap Pp000 0BP HR838#@0@sJ@N@@]pp ["Z000q G2p00cp@0CN@N@@=p "@00Zp0z X0  0 H000 0X  iwf ^$.#18 2:R[ TR.&n UR'w AR.)| ~ @AqW B!Œ p@ i@W   R p0  fLX00 0 0 0  0 "X 000 0 0 I0CPK O0  ;0000h0@@@p h00S0\ S00   BR00009e9edTd9ed9e9e9e0A-`pPvo@!0 0@R pGorp#W  B$R@R0 R0$R00    dM-@QpTM? 0PS` VD3 ^pQ+ A 0p0 00 [ 0 0 0 HQ0 00000up vPRPJk ^ 7 Rdp   F$R'R R @  $R   @  @ H  00 00z'1[- 0 0  0 0  F$RR0R00@ 0 0$R0 0000@0 @0000000wU [څpP< 0 G00Sf  F$R!R0 0R000 0 0$R0 0 000 0 0  ὢ<000FdA-pQ%PAAP `!`3X7PP3@PQ @F)PP FT*@@EQ pF0fpppG0GS0p@G00C 0    00@@q@000CS000000b@/M- $pX"@X@@T6{`2{8 P-p  B0,zX{6d<//----P @P///T:eA-`P8pH@@T @DuHPDP :ep@-PP P@P@pP @-@P 00H LTL H0H0L  :e0H H L / :e-TMP  ᚡPGu00@000<040808040@0 ,0<0,a%TЍ$daata|axa _qp@-` P@@PPwup@O ឡ00GPpRA-`@pP@@P0zPpV/ d@-@ }0P0jP d)dP@-TyoI?0P0y @ 04/ y;d dhd@-M-pP`@.uPPPE uP0J*`ZX tPtU `@` 00C C1ld0dldm۶@-@ 8y0yP a^ ydddM-MPS@S100 M`A 0SS""VpP0 ( $0 tP( $0p 0ZW `PU 00 `K!0`FqPZ 0 6yP  eP `0Z $y` `cc@-  \ P<080<@ ЍP00<]>eKdM-0,p@"W(0` [0T0P0pG 00T0S [$ P ^@@Ѝ   R @TP 010 (`ЍM/.sP@tP@pG !@P 0ER s P stPW0 !@@G,dM-M0000P0$ 0spP ܍s`0P00Slsl3|  R R0 R `0 R R R   V  <1V C 0 0$R0S: X8 0020, <?P. PK<as,匢s @Xu 0`dVP*Wa OZpc^ R 0c  0`0p1A,00A00|0 PV|yP XP4,[1 =s,@Z 0 ^0S @@T  X <a s@DT, p s댰,N`|s@Pw$rp0MSP~D|`Jy` u2d\:e]>eJdld0dm۶ld9dOdp@-@PrP 0P.S0Pb0C0S PPpc- /- /@- @4/ЍM-P(0p`=P 2@ T ,@P KwPЍ @0 SЍM 0RP W is 000 ;/WP [s0 u00ddJdOddPf`d00@ R/a CRWC/A CR7C/@-@PPM-@P`0S SS[  P Ѝ0Kp [ iaaaaaaa(a4aHa@ P ppP ppPZ:PppP@@000P0p@000Ppp@@0@ PpPp@-@rPPr}PPp(p@-P Ѝ@-B*4S =0*4`pPH P`UU 0ES2ꈒaha4aU$4p0W$4/ 40 4tP- hP) UXQTPE;0p`44S0P (4S 4 $0#S  4P04V Ѝ^rP 0`0~P(4$S dbPh0 "448#8S08#8Q $0R`@ehDeiDed@ejDekDe`DeM-hB0P 0B> T*T04PTT T$T8T4T+Tq, <P +v?(40SC4S+4 4g ı p`P ^ 0 4W A\J7 AuVpGW0 (4q(4SCi40404S ,q04PB`V p`(PP4S/4 $0S0 Q  Q 0Q  R  ABQ xR00 AAPA ^Ua AR\ 0S Q40*40 404ЍuP`@ed_ JdM-Bp`)4S4SVS-+4S 04S ,Aq04P0004 PPaQ+4S+T$ 4RM0 Q*4 $2 44S 44S9)4STUUP S4`F0C44p04$4P\PP00SS4S PP Q $4P\PP0C48$ S0C08$450C0RP'[u u4S0)4t(4SC}4044Pv0)4U+4 0#  Ps(4SCe404`@e/P@- x@40CSUSQOMKIG0)4@4/P@p`@e0%'5/c|d| |0p@-0C p@R0`P 03/P00p@T@R @TdddM- 0S  @7QB Q? qy ЍMt&Q9 1QE0Z 0tQ bQ CQ IQ|Q$ QZ00E000 lsh 0S X QAaԜaܜaܜaܜaĜaܜa̜a E0Z ss`V- 0S* 4 P**5u0u#ో0嫁᫶S'Ue s00 0`tsЍhd`\sTЍMeldwdd\d'dDdddd ddOdddddddVdp@-@3 0@`0<0Rd9Rd,RdSRdWRd(Rd5Rd_RdLRdd1RdCRdp@-@P`0P 0S  3/Pp\p%pp@-PP0@000LP,m mpgdQdM-@p.'nPP Nn@E00P@@s00S`  r`NЍZ  ,s00S l  5@P00` P@ 0S 0CS)ccM-P`MpT `ٙU  9PPr@ `ЍmP `mP :mP  m J }@P brZ R  ~mP r R0 . Hr@0S7 ,0S; P #@P UL \ R\ UT  ⦙ PZU[ T ᜙J R Z z z  @P;  r R r@v0OoBZ@T P q\@g <10S4100S00 Q1QR1 3 #20JR ,` lP qq:  @ Rx   R  dP!PQ!3#" %c0cdcKcPccycc̪gdccM-p`WPP@ 0S@ %@ lP @0S 0 3/P @0M-PQp! #lP l0K  ` uP @PЍD Oq(00 0@P @qgOdOd@-0bS\  CSP  L SD  87S 0a0( q Ѝ tSfd!Sd'SdSd*SdSdA-p@P 0<0S `> 0S  SPC0 0A/%M-p@Pa 0<0S ` 0S  SPC0 0M/%M-p@P@ 0<0S `0S  SPC0 0M/%A-MP`" P&p堀@, P @ 0xp l0  PT ,@U P @TЍSOdYOd1US)p@-1PS&s/ 0R R0PS @S@QPpH 6kPp, RkP dp/p4d8dH-0?0?0 0MPP0 @P K`Pd0S1Sd`h0M-MP`p0 W00 0M00pK $0   $0P   p!UPR o/ @,\Z^$ Q  \^ <0 0800 080 ,j0 0C?o20R0L00P0Q \  \^ p@R \R0 Q80T(P00<,0LjOdOdPdgd@- 0g ЍM- M0 X00 0M$ oK7PP0 p,P  xoP !Woo1`_P@0 RR AWo0 RQ 0SI@T0 SR 0W$0 00$ 0 `V0808 0 R \0R0Q8 0 h0\h`  00 0D oW SR OdOdPdKdTdTdTd@-@ n 0 aЍRd@-@ P!0 S M-p0 S SS`0 @P0S W  n iP W  0n("448#8ጠ0 [ *0 P0S PP iP W  000SW  H0G I0J0 1P W  0 ꐱ  0 08R#8S W t 0US0S W H @,Si @  0 SS QS W z x RpDSPWm  h0SꜲaadaada->0  Q1!0  0#1Z>0?De&Pd]PdcPdPdDePdPdPd"QdeQdgdQdQd-\M0 \Ѝ@-dM0 @p`mdЍTmP`P8p0 00Ppm0 pRdRdRd00E-p0`u P0@P,PE0, 0RT 0S 0S|P Ѝ@,P,PEp@-`P@PT@p0Sc@P  p@-@P0S p, 0\/0 S/|c,c@-`Pp@hP0avP Ѝ@ TtV>` P0@0,@D, 0R 0PSPP ,@c|c@-@`P cp P p0S U@ (PT Ѝ@- K@P 0S@ Ѝ@-XpP@ 8p P` 0S m@ ЍEc7@- P"@Pl Ѝ03c7@-@P\l pp<l@ Ѝ0P@P 0S@DcQc0<0S 0S /%//xp@-@P p@ p@-@P p@A-`pO PP0@ Ѝ0S0S@ ,@0,@D, 0RPE-@p`0<0S% 00P0 P0 :/V@00 0 ЍA-@pP`0<0S 0 A/%xs@-@ `PnP0 Ѝp@Ѝpxs@-@ `P[P0 Ѝp@Ѝps@-`@P0@P,PE0, 0RЍpH0S0T@,P,PE@-p PM-04P{p @T 0 D`P( @ @P 0@ 00? Ѝ `W  [@P@ @,@ 0,@D, 0R@ 00 S|0 00S00h   R 1( R U1< PP3P#2080p0` 0x0@0̪A-0M @ `0TpikgPP @ P00L00H00 0 p|@P 0Ѝcp@-P8@P  p@-p PP0@,`,`F0, 0R Ѝ0S ,0@,`Cy P 0P PP B -0Q 0C?o20#S A0SRࠃࠓ S0p@-YdP( `@f EED`f0 ZZY` fb`pLep@-@(M 0`SP@ 0PS  pj!SP  0870 PFPjP (ЍpLe"8d)8d01 /\d01/\d 0p@-`GP d0g@T*p801< Br/, A, A\d0@-PM@$j"  F70 G0})P4  .ZI) 6E EA0'30 0"448!$#8$80:;0 ,00"44,<"44<00,0 0 0ߍ0ƦdM-a匁Pp@Uj@f" FrfPPfGo@ T0ЍMPcTd;Q.). U @ 07 00 0000 S  h00000007 S  XVP7Ѝ@ 000Me7dq'7d8dLe Me8d(01< Br/QQ\dM-p 0FP@ࠈ  0`400U } HiЍ0 B&,C  E B C&$ &( E0 F4 G2e} R0  Li"". F0  GPI8dh8d(01< Br/AA\dM- 0 F@Rࠊ {} NiPЍ Gk2e}p :i`0P0VB[oob0 BM',CI E EA B= C8'$ 3'( E.0 F($ G$2ieV}' R0  h0"". F  qG P` 0p400U } hI8d18dh8dA-`p@\@ PP PQPVPR:PU: W @@\H 000B! 000xdddM-$q PR,0(0,: R) R @   AQ*   RtP ЍM k@PЍ0  0PǏ @@   ddxdM-p吰@`PTv 0 00C0@PP0S 0S U0@xdddp@-@@` 0PS0S 0 `P00pdd@-@ z000dd  p@-@ PP  1Mpx@-@P@  gcd@-@P @  gcd@-@P@  gcdM-0X00R`pP WPP{PC@P Pu 404080,0,000(00p,0L00 k<4R[ ) RT ,RR  0(1Ha06/,'0 1 00j \0ilP0knx10tp1S3/P R R R0Hq 7/V ~010101011Y =M 9M 5MSW`Hq0 7/Daa$aaaXcd\da`?d\d@aaaS\dI\dG\d\d2]d=]dC\dE\d\d\d ]dKdOd@-P@p@-`0 @00P0S R0#R XXX 20<0 0 0p(,0C000p'c@HdzHdA-`P@  U|p `\00`PF0H40@ S  X0HdcHdA-`Lp@lPL0 0BpL 0P0 00@p !0h `,0GX 0 F$4 HGP $ 0F,Gd HdHdEdxdicp@-`QPz@ P  P P  P 00PP `X p80,04000  W(@4Pp#Hd b b0 R/4000S/p@-&T8P@0pTPJT Wmp [dp@-@(0QT0pQP ||W pTdd PJHCD0D @ R$0W  pZdAc[d ')[dp@-@(0QTa0`pQPPPWpT48W pPJH@C0@cK[dj[d @-?0 2z x<40<4L40L40`4d4h4l4 04#$$0(8 <"( 0 4$40  &01#36/A-`_|@  @0Pp R 0 0`d1h4 8l4 0< @202,888C2<2\ 20 0,0202 0D H2 02 888C 2 <20P220020*666p 6!*t0@Sutt0<4041707t<48 8<4<40<4t 0 606,@ T 84p#8D0 ?0 @P0V0@ 0@$8Hdp@-P@;p0 /ze00S 0  /Meze0 /zep@-@`0S Pp1h0d1\0Pt H <0 0 "ppppMe >dMe=dMe@-ĵP@P, 0P) :QP V0@0|P V\0`P V@0 P0p}00@WdMeMeMeEWdOWdMep@-hP00`@`0 R L000@ \?C"0C" B 0%p cMeMeMeMeMe@-`@]PP   QP^PP 0 ``0@@0cPP Ѝ^P%P0 S P^P 00P0pa F}x0x x@P0 bU D00 S Ѝ@s^^P Ѝ@^&JdMeMeMeMeMe`XeMeMeMe7@-(@PUP Ѝ0Me( (0@-0 0/@P!`Me Mep@-dP0S pP`0S\]L^@P4 0 00Nc@PppMeMeMeA-T`0S0P0P@T@ Tp|Y@DPMe7@-@0SS`0 Ѝ0@a`|| QPlQ`h0Pia`0 |00D D0D0 db Ѝ0MebMeb&JdMeb`XeMeMeMeMe0A-`?o2P0S 0Qp@ TvPp0\d0U@P! TLD"0 S1:d,E< j|, e|000MeMeMeMeMe-TMP  |LO00<0(08000404000@0 (0<0dPTЍE'dbb|bbb/04 408 /ᔿd@-蜿dA-PP`p@PU T@P { 0 $ P 000408`DpH0S 0 0,! 40C0 ( , 0 0S 3/P @@mT8 V00W0S`ASdSdddScSdZZA-@,0P`p8/P Ƞ0, 8/P0 00M-`p(MPU"!0@ 0T3PUxVX  F(00^B$0B"0B!000Cc E(00PB$0B"0B!00 C 0P.R 0D8PC4C2C1A 0P P 2s 00 # p 0AP (Ѝcp@-40@SP 3/%Pp@v:00S //00S //P -,^ 0 8//M- P0S 940S/ `- 0@SpĀ @ yS00&QVrSm@P D@ ikQ_S  `@O 4d{dP4d4d4dp@- @40S=,0 00` 0  _   1  /  00p x Ps0  d   00|00 S c  ? 0@ W 00 40@0?  d00@-@XP@@-P 0@T 00 84/Ѝ@- @+ P00@< p@-40@S 0<0@00S = dS"<< R<8p@#8 (`,0 `(`Pp> 0@00< ; ;@0 0P- 8#8 PPp Pp  Pp, <0 < <P8#8 PPpU p@P Pp  Ppp@- PPp?M>M @ @ @ @   Pp  @ @ E F,00,0(00(0epp@-L@@ p9 P7P  sD`@  `V0p e@PsNSds@-@P` 0SS  08 Q P$`ЍpTSdA-@Q`p"PP   Q1Sd8p@-#8@` P8#8 98#8p@  QRp@-,PU 0p@/PH@0 ^ p@ p QRA-`0pW A/`PP0@0 0S0 A0 A-p @`8#8 P1 8#8 {A-p @P8#8 `k 8#8 P`A- P; S 50@0 pk M9 Sd0  S 0?F@@0P\m``iQ. M i@Cd4d 4d@-@pP@@-0@ cP@@-@[PA< @M-`MP PP  00P00 8#8Ѝ0Tq#1000CX "<<"$0,0 ""$,   [""$, H $H""$,  8#8 P T  @P00@ 0 00PPDdp@-$0@0CS" $0 CR S S8#8 m  0 0 08#8_$0S  0 090P$0 S'  P08#8A  0908#84 p 09 08#8%#@.p@-0@ h0 0  0 <  @-0@  .0 000  0 0"=0   8#8000 @w@-0@ 0 0 0 `0  $0 S8#8  98#8Aڢp@-@~ 0 Pp00 k8#8 e0 ` p@-0@ T\0 O0 J80 E0 @@@\p@-9@ 30 .t0 )0 $0 < 9 2 @-@ *@-0@  ? 8#8 00 $1 1 0 0 0 0 0 0 0 0 p0 P  888#8S 0\!@A-0P EHS$HCdp 㸁`@dH$H 058#8As@-0@  2 z1 u1 p1 k1 f1 a1 \1 W0 R$`V'P0 I0 P0 P0 8dJ$0S  q0 090'$00CS0  \$ 0BQ000 R 0 R0  0  ЍpK!D!( F!3M! Y!@-XTPLHD@ < 840ddd\dddd\dd\dܿdD00/D00/D0$0/D0(0/D00/D0 0/0@-P)J0P/4dOe/ 0 , /Oe0p@-|P@x`PMTPЍpP  tnH00@000<04080@0 00D@(P,`<0,@OeT4b`4bl4b|4b4b4b<0p@-@PTpzHP,@0@pOeOe@-@-0<0@0/@-@0/Rp@-3  pPM @P 0 PK P   P  P P RhMp P MLsI@<oI PgILLddPLd@-O@0/@-J@ 0/@-@D$0@/@-@=(0@/40@-00(0 $$GJ! 00@-00$0$ 4@ C! T @-J  P@-@ <@8 @-@@P/dd 0 0 00A0 /@-(d0@ 0000  q 0/p@-P0000p@0  /0 //A-0P0S' V1U 0 S180 <0@pP  R  0J 0 P P@P [  C0S S  N@P [d\d2]d=]dp@- P`LLrH!HLm<L0@L$PL@PL@PL@ PL@P0@SAb|AbAbAbAbAbAbAbLL >0@SAbAbBbAbBbBbBbAbKIXRJJ@pJI0GJic]d ^d^d^d*^d4^dD^dx^dU^d^d@-@^L0S@AQBbBbBbBbBbBbBbBbX/R D/ R  R  /p@-P@ 0PQ P0S  P  R  B/o"oppp      0S/<\ -^ 0/M-M0`0@00CsR p000  0PZ $00 0P -  0 <  R ^ 0/ R Q  Q* PA$  R$ R$ $ R $0S @-50   p@-`P)@]@0S UP! 100!1E0`P-P (103 0#R$10C2r"0Cr!0CR0C0C#@0b P P(103 0#R$10C2r"0Cr!0CR0C0CS0p0"2 000<0p! M-p P`㬠@0000 00UV00   00 0 S H 0W0VPEU0000`Gd'p@-P@`\00pp@-P@ 0;:;:00S  000@00p/p@-@p0`PP0QPp@/@-0Sp@-P@LP p輝d0<00S @-@3/%/@-t R  /0@-hPM0U 0T0S $ D@P 0S qP 0S h0 qP 0 PEP P Ѝ0 d@-)0@0 00Q00;0000/0s/A-@p2` PP V80 40000 ,000 @x}! 6   9  S <<0  /7'/@-@C0 R0BP0  B,ĠCC p R /%/%/0<00S /%//p@-P{d`@w 0P( 0(0 C`V0 ( C0 ( p@C'M-Pp`Z 尠0@!0 !0 !0 !0 !0 !0 !aCGP0 ZC PV``W0<00'M-pD&lLM0E5P@Ѝ0 000<000%0T@P  @` P$h +'n$0 ;?0(0P,Z -n,0 <000`FX50T5 Rb P\0,%(P0 0 P0 P0P0P0P0P0 P0$P04  # , #C   | Bp \   RLB # R B QR U P P PZ(0 0]S @@@q0@4@@@D@P@T@`@ d@0 \0 PR0C04P200 000 T|m'0 T00V0B< T B< TxF0 < <Em 0 y Zm)0 Tp) TxmS9 S ,< 8,(0  0090008171;1 P(m'0(0?20SF0 ?SE0 SD0 SC0400 ({ 30S410 E7P0    ".  d3 `3 0 ( 0 0 0$ 00 ( 0 0` 0S{  PPAHzEtWddWdWd Xd9Xd Oe'0ZXdXdXd@XdM-(p,0`P0zXH%\*@t ( 㪢 l(0"r@0?o280! &0008000 40 80 <000 40 80 <0 00 dQ40n80@4>N @>N[ 0>>@@HA A00 AAP DЍMD0$@A@@ $001$0[0$@0A<@0<0\ 000 010TWX ЍM/nЍFd' Gd5GdA- M<P`p  @k'0X 0000%<0@00@%8D0 80@Q: ЍA- M<P`p  @k'0X 050%00000%<0%80A@0D0 80@Q ЍM-0p4@P` 0V0 J S0 `F|S0 Ѝ@-P`p@i00p0  Ѝ@-P`p@Y00p0  Ѝ0<00S /%/0<00S /%/0<00S /%/p@-5`0#" 04 P2$|@0#" 02#T Dp@BGdM-0}>CcS@Cp ǀP P B"ǀ$ , 0C28?8 70A20 1PE\TP 0`Bbd!0C2?0ld`[7!0A2880P0Gd@-@ 0  C# ,##Ġ ,##Ƞ ,#<00C"  00<#"Ơ 0"4 0<#0":"(0 #" }. NGdp@-P@Upp@-P@LPD C< p0 00L:p0 00pddA-P@,@D,0SD0,@p4<`<`F<0S D0<0<`C00@-  P@TL P@TD P@T< P@T4: @T.  @T(@ @T",^P   \  \   \  0@o0000 0<0(0S /%/ 0?o20/Oe@-0 <@T% @0 4/ЍM-0y `< 0@ 0[% 00P 0 @;/0S 0#S0 4Sp000Ѝ@-0 <@T% 00 4/Ѝ0 0<00S //0 0<00S /%/0 0<0 0S /%/0 0<0$0S /%/@-t@PE0Pp0,PE, 0R 000 Ѝn 0P0T0S``WP 0P0V0S@@,PTd@-@T tP@M-MMg@@`P%-0Ui0 ^,i0p00$YrvP [ DP/G? $ 0<0 $P'09LH00P00E0! 01ܱ0C0[M0!"00A@= P   0P] ލЍ$D  |P 00@000 rP  00 0Z0C0 0U P iP$ R P R  0CP0P 0 P$00$0 0dddâd٢dic7@-@PLZA0 6P0Q Ѝ0@KA Ѝ0@GAvd$ddd1A- t @P'&0P`hAh,`Fp ,0S@ ,@D,0S+0S4v@PUA0@@DЍ ApP,`,`FP0P0 @D0 G0S,@@0,@D, 0R D0 40S z,@OedTd6d ddp@-P/@`Q,Y0 00p@%-;h,Yps@-P@` y_pk P0 sxЍp@-(00! / h000h0/000S/00/<PA-`pP@<t @T PU@- R @00  000@P_@꠆c'd@-@T000@A- `PV0 0F2p@@i0# " ql WP%%l  0`0 0PiP諪0@-0000CS @ ➳0 ;((50 00Ѝp@-@P`ai*. B0V @ 0 Pp V@F0S`A?p(d@-00 0 0LP?m蠆q d@-00)0(0:P?m(<蠆4)dp@-0`0Pp@00 00 P` p@d{0 1 00 V1P0*P}=Pp꠆'d@-Z@M-`PP!00C0;뀀}0@@ p0W 00`0h0S @;Z *,Y?@bc0, M-(M, P p᧰PTT8?@(Ѝ U``*?S`V=@P `0   PV 0 `0C03 0PF  Qf Mf ! !7l 2 4 < (<0H80<00S-H0Lh0Hh0Dh0Sr0 0P00`7h4hP000KIG`@0V ` #  $ 0$ $  0 0P@o AQq0#$ 0  0` 0P 00# 0vPec%c@ A-@P0p 0`P@ :$Od0T?@P@}:T*4<>m@W@, P@Ѝ(dM-M0, g0 0S0PS@00 0 0;;SU3 0@P >eS 0@ 0`  =e 9e0 000001l`$00裧 000(000 ppSpp C4 ( 8< 0 =1R9,  R B/o "6010 0pSpp706cp`00XR 0?o27<000<40 0*"**b/ 8 R 4<D 2@0@0D P =w3 pp0pPx`@@@080,8 U8 @0J`0@p'Z0S 03 P# "   `00 00` f`0 ,0f000f00?0 000 7 n90cF#?Sdc f, ffp00 W9P:(0` 0 wf00@0 0 1}P=00 } 0  y 0 0)1hPl k00  0  Pb 0 R00S 0;f0S <XPK#0@S0 S' S S @"0 0PS S0$ l   $l x90&C0 (0 PЍ0'd5(d(d'q(dR(d(d!Ϡ\ 0R/M-@M, 08xP001 81jS S> S0`1@  04#$R R RB `L8 0T U PUPTU OcY ЍB'0`@`0`0Sul"Ah"`0 4 0`@ b000000000000 000 00003/P 0P0000`       0001S8000R*0 88(0000000:00 ^;`*00 $R R R R.0R R1 810000 0:0 0 0 8PЍM##d#cc(dM-$P@p`n`VW00P0S@P<0U0  Lb20202020000S200S|200Sp200S Xp`AP000 0(2 KPP:T03/U1Si00j `` b0 0 :p$0P@00p4p80d0`` apppd0SfPF 0P P0 Sc 0 00    $  "$   $  "$ 0000 0 00@00 @000h60!( !P]:y3/PP 0  Phbhbhbhb'dd'd@-0S 1 1  6'PE-@}Pp  P 1! 1a|``P !8:8:8000 0 Ѝ He2~6.0`0SxPl  d0 3$0 R0C0 4 200 00p0 P'dOe$b'd!M-`Q5 p0S1 "5 P0S( 0 @D T#@ 0R 4P0=S P@D R !-aT:  H9Ѝ@*d@-@9@@-M @x9Ѝ=d$0P  d@-0(M@ 0T 0 0 0 (0 G*P(Ѝ PDd7@-P@P 90S Ѝ0@-@0  0 0 0 0 00@-MP@P 9ᚘЍ0w,dp@-P@P &9pJ3dp@-P@P  p@o9p@-P 0YPTP1S@-@o*d 0 @-Pd@-@P p80Kdd{/ 000@+PD0DЍ@8괸   ) Ѝ+ddDd%P 8QePe /d4d8dA-0S ` pQ 0Q@%  Q"  0BUP!m &P0100 S 0 S  1 S:00P 00 S2 S0>P@-0@SP 020C00SЍ0C00 00M-0P<1@P(@Ѝ0 0 0(0$ Q %  R@ p @p@ ,pWO*0SS00  D ,0#0 0P0/o"X R,0<1K 7P0410p  0 G0 .0`0  P 0 p00p0` ,1S,! S0,1<1S< `0P `VQ ` V Q  Q ` `[o ($ 0  OE@Pc M-@PpK0`SP \S/S #P P0S /S\S0S  ERHc#P0$  $0000000SR EP <h#<[1 ! "P <1S "P 0 1 P! (0S00 00$00 0$000000000S{dH,d@-@pM0S I|'0t'嵳 0|@P L'@pЍ ;O & @+@'8Qet2d2dƦd2d2dp@-\0M` t@P PP DP" o0Ѝp@A-0Mp XPP @ `P@ 'P00  v@P  @P0@H0Ѝ@M-HM@ pPtxp`%0P 0 00Q Q0P0J  0P0A 00 Q A108V .UPU P@ 0P?0V0"0 0U PQ`V000`  U  00׫0P 00匨 动HЍh"P@\&0 S2 S0>T*0P0 0:0P & cPU  S0h QN W0 00 h00h0P@0 S2 S\1>T*`[ h 0P0 0 0  @Z h 0P P R" 0R .P*0 00`  h0 0 PU  h0lP@u0 S2 S0>Tl*`@2d2d@-Mc8`P@P R&Ѝ.dA-p` dPP @ P Mb:@P @PP 帧ᶧp@-@` P*P -hM!! 0000 !`pp@-@咧@菧/0@-lMP (@P0000 0%lЍ0/dM-PPM  ML\ʂ\:Kx%Sj A0 $0   0 {P 44%$0 $ B 0R ( 9M( `p@DT 0 c 00 0 M 0 S MР20 FZdh0a@ 0 `0= 0 4P$  Ll3d|c3d3d3d-(0LR0 4#00 #cs@-`P@PЍp0 .RVDPUD`%PUD$ 4 8$DL7@-@Q PP %0S@U@T Ѝ000 P0  0B8C8/ @- 00o"ᒦM-  B0@8M000#03P00S0000 0@0C(@A (,,040LPX T8<$P@ $AQ@> @@0  P5 202> @PP@ `@Q@P>@ P *@@Q`҅ 䎀 @A@>(@CT,`DQ *!B \ L B  b S %0B00C <2결@{JXT @^@P@T@EX@㲠Ჰ@ T㲠`V$P. PpCp#  h# dC$ `#  UP!U!1p*  @/o"P *[RP3P"U xЍ@T x@ంT∀ᰢD`` $  * B(   A`@Pg:Th:@D$`@ @ @@A`0 45 @4 ``@0` [AGP@@@x@PDU@DH$HTDEQY ,@ Q)(@P@T$ RP A8PPlPU*PPFUP\P`P[VP3P"U~P@PQPaPHEQPP @``R ( \  p0a@A̠\ LPp @`P ! cccc P 0S 4) S. (,08<l P L //R9 <S1R  3Pp@-@p 0 S(0$0  S0$0 0P(3/P U0Pe0 E20/U0$0( 3/00P0ES0$P40p@/pbb0%@-@P  R $0S 4Q ( 3/($0 3/M-RH M` X$H 0@3TLD@DPU\EPE,Q) Rpp2W$W  Q u0`ppV9@9P0@PVX2\TLD@D9 ЍV}GW=0pG 00RRR0 R  R0  R  R 0   R0 R RR0 RRR@R0R 000 0 000 0@00P0 Sn9Vm0`@h9PR0RR0 R0 0 R0 R 0 R0 R 0 R0R 0 R0R 0 R0R 0 R@R0 0 @APT0@PWM-P0M> @T; 0S0S508` S 00 0 000000 R&4000   ,bP0`0U 0S`0   ,,`P0`0U 0S  0&$ 0   ,bP0`00; U 0@`S`0 P`000 & @0W1![ R P  A \  B G0   @0 pG 0C @0@0S(0@0000;d W J 0S  \ @ 0Q02@057[W0    W [pGE 0 000p(08`Sl0L00T0/>0T00 l0p0P060h000`d000h800P6cPE0 h0h R0*TL 0SWh 0pGePP PzPk6c0EaPC0XWP pGePPR6cPEFh50000S S>l0L0T 0/T0pl0 ` $0 Y 0P0$05fl `P  X X  d G0P04V004 WR9T0L0  R1AW 0pGeP06&aPE\!@ P0*hwW pGePW pGePP6c0E cPC 0 000p8`dRQ/M-` A@ @@R H P 03/0 P [EPET  W DR@ЍPꫪ? 0:  Pp@-@  P @P. op PpPM 0  pHDdM-M`pP U@d @Pdߍ[   !0PP!0P @]WdA-`pP@TQ  0P`1@p@-@`P0. 0 00  000p-P 0 /p@-PQ 0S@ 0p 0p@`'TQ `Q 00@P 0 pd d0 -M   Ѝ`'d!ΰM- P <0  \<0 0# @c$>!># ! @T ЍM P# pC'0 c5( > `!PCUC!c6Z 吺. 2SX>W U \;A?o20S PE (0 0@S U HdTdtTdTdxTdM-PMp@pt`@SP@ #@T#@x 0R3!:  < Tp1 `Z@D04# 0V&0 .@S P00HC PЍU0 1 U0000 0  `0 `  @0Fd&7dJc^'dM- MP@p@S`@"PU"P001(0 !(  01C Р0$0 $0 0P0m, $廊 ֊,0@Dp'P K T0@- R 0 R0#01 # 0 @PUS0 B0` 00#01R #0  ..  .. c@-A-`PQp@+"`F0@P0T  T # 2RW :pW`0?@ OP@-66d0 0 /Jc@-@0P 0C40S *000C Jc 0 # BR /  0M-^ 0Hp0` @ VQ TЍV TPN UT0^ 03#0N2'*QZ@ 0C TO@ @@@A@P\ TPN @$ @$HU 2@PE\VPP0S pCQ@ P&U( `pW  pZ#!pPW ` `v@ @@T 0@C$0 0 S zE-@ $MPt` hp 0 @ S$Ѝ 0000S  0w ?d?d B@-0 ^@ L QT^0@-@X h @?d,kdYd/0"0M-Phh`Ap @ \ X( ^T pt@U@@D3#VZ p^ >.pt00Ct0T>. <#p PEtP Dx0Mh0hA-@@\A PH\P`q\```L Q\0B C   @ A U`M-` "0F`h  p kP S( R:Z  B@k X * # R@e @e @ T T 3R0C `F  05 0P 0 yP@Ѝ r"p@U@Dp@-P`@P pf?d0p@-P`0P S# F 0 00CRP@@p ^Pp@- PPh@ Q0 0CS%0 0p0SCpt 0Sp/0p@-0l00`0h0@ @RP <H R D0Vpp@qDp@-P00l00@0h00Upp@]D2S0 "2/)d2S 0"2/_d0 tP/mPSP dP 0P//n0@SKcKcKcKcKcKcKc / / / / / /p@-P`"@ B202pM-0`4p@PQ8 0ASxLcNcLcNcOc|OcOcLOchOc|McMcMcMcHMc4NcXNcNc00 0@0 0PP0 000 0@00PP @0P JRPЍ0 RP000@P 0 @PP00@ 0 ` 0 ` 0 @PP 0 `}00 0 @yPP 0 `0 S   0 S l 0@0b0 S < 0 S R0000P ^  R{0000P ^o P_oRU@,fP PE_oR[ 0 001@[ 0 0!00C0 Jc0DdM-0@p0P` 0 0PЍ0 0P M-0@0P`p 0 0 P 00 P Ѝp@-Pt2 E0CS 0@20p2dA-P@Q`p0S 0CP0[0WURPE `20CS 0@202dM-2@P`p00 .R#R RB 0b0QL$B Q(ScRcRcRcTclTcTcTcRcRc0Sc\RU ?R [R b^R00@^R |RW 7002p0CS 2 20000Ѝ b \Q ]Q   A0C0 R\12b @ sb `0 0)S 02 W00S0*R?Q0 0 C?Q0 0  PI0 x>d2dddd7@-P RRRRR0^0C?o2 2Z@W00S0SJHGo Ѝ0E- p\M@` P   0 000 u Ѝ0  PiPU00\0SR l@-0@ P R P @@   RQ @B/Jc  @00S/@ Q/00S/ 0\ 0C  R/R/- 0^A \S  0 S00\0S / P0/-P^\S0 R0/R/0 0QB/p@-P@@0 SRpUp R0  \C/p@-PP ✆@P@px0\/- ^ ^\ A0 R/^^ R A-p@-@P\`@T 0PS0PpP 0S00@QeP@-@0S+ Q sb0A S/ P/0A-@ph`P dPU@H@ PEP P/0\/h0S 0h@-ܻP@hʻ@-/<# 0 Ѝ H@-h0SP0 h垻P 00[ Ѝ5d5d/@-@@@-@H 22< 0B0#30 !4ׂCp@-`@P@P 0P:pp@- `@TP1P!@Tp耖0 6#8##/4d0/4d @-m0 ,꠆-@-Vp@-!R!DP@0!6 !Ơ! 5A0Q0p0C0000p 03 1A0pQ0C0000pM-00À P$!Q *M.t .`  0!  J"r"p`""f ++#8  e B0  L! q  e` B0  L # !`F0``L0 B0 L L #GGŧM-`M†` Z& `p@P 2 S) r0Qp Z@D-p/ @D-p Zj J ` @` 2 .3.30@D+pp@D pQ: Z@D @D0000Q@D> W Up5P0S U003050ZPX0PX00E 0S  0 0 R$Z?@DP@D 00# Z Z@D-p  @S50 RZ?@DP@D 0 S50S50 BQ@0 0S ZQ 0  RZT`ЍR 75 S50a dA-R``Pp@k0 0 CP PP  LPTDS50 APP0D 0c@D0P@0 S 4 50R5 dM-@M` 0!0!#  0%0S  R V050Z030J50F@Ѝ%S V05P$-S 0S3 00C Sp&00C \+0.S0:00@ \ ࠓ,*P/@0 )P0+S S #S *S pPP@PP 1!0pA@pWpgP +0K00@ \˿hP LQZQ zQ tQ 0xSbS%S XS V%03050S Z0ƅFlQlPLc0CSfcicfcfcfcfcicfcfcfcfcdicicgcfcfcdgcfcicfcfcic0  S50AQW0GWppg`p V@10405 10` FQWpGp`+ S50@P0  0 00 aS' ISJ MS w P!Pp!iS@ mS@P%!d, 0@:!SQ0S  0aP p00 0 P @P0, P p0 0 @P0@P4S,@0( $0( $0D@QS @.0A0F q PP LQ@0@ 0  PnH]lQ@ ZQ hQ0 S tQ 00 ? S!(A(?7dJc@-@YP8TD -@- 00M ЍЍ/0 E-@-   Ѝ Ѝ/@-AMM 0 @P AލЍ-@- ЍЍ/A-DP0@p0@P 0' S`A0EDQe7@-P @P0o Ѝ000S0D   00xS00 0S000S 00/Jc0 0 D  009S0CWC/ /Jc@-P p@`@WU` Ѝ! 0@-0@pP`P Ѝ 0S R 0C0S R-\ @-`@-@ d0 00kS mS gS000iS  0 BR00JcA-P sp`@@WUЍ6!!`@-@ |0 00kS mS gS  000iS  0  BR00JcQp@-P@S0AU*P Q P0C Tp@]UTpJc 0M-X'ڤ0PHOBDEA`Cp dpQQZpp@0JE$80 1@ 0@QmcT0p@-`@PdQQDopxWdA-p!22[.B"B[(BB 0`0`#3`0&hD1 h@@$G 1{10R0 QESEPEU%0`00 `PUJ V0   0 0.50 @D< 20@D0@ 0Hd?Q9o[PJrQmQ ųM- p@p`83v%V1S00"0 %"QP BP%(k'`p@-P`3V1Sp00p(@@C0 00 "0 0S )% 0AA'`S%0SA-p@p`2RS R ;% P B$'`0S# @@F$0 P  R 0S$ 0A&`3V%A-P`(p80@- R(1S wELFdΧd0 00( 0$ 0 00 00/WeWeWeWeyQe|WeM-鴀`p  @ P`   d`$  $ $   p$ЍM |We;Idzep@-X`XPX 0L@0#  <00S0|00 p@WezezeWezec&Jdx0P/@->` `00@SH@00S04|00(0 WeWeWeczeRM-PM ЍM0 @4 S0 4SXpW0S  ` 9$ 0R0 4 S  S) ЍH! 00000 0P@$  $ 0 $ $P p $ЍMep0S  #00Z`P  #0P`P P@;/ #?0000czezeWeWeWe`XeWe 0P/WeM-Pc9}5RS @ @  ""$, 6  B B@B S #,,#4 <02   C, C( C$ 0@P P]0000@40@^0p0ppjP6<00` \#7 0         B?PЍpdddA-@`T(QQPQ3 30A R,S}c}c}c}cT|cT|cT|c}c}cT|cT|cT|cT|cT|cT|c}c}cQ ~c}cT|c }cT|cT|c0}cT|cT|cT|cT|cT|c@}cT|cT|c}cT|c}c  #P@  Up 0 qp "00?Upژ@0 `?p㄀ t0 h \0XPp "P5 dzezezeddWe+ dWeWeWeWeveves@- `@" \0RTP00_0 lY0 l,Ѝp@QЍpcScWeM-M8PUPPCSPDQPU0@S0S0S 0  0t" 3#0SЍ PZ 0 b"2 R0 R 5R@0SP N"0S  G"|2 tA"l20 l@ P L20S@+00S $Z  &"00 2 ЍMLR 0 0ЍMjz `PP "0S apW W Wl@``@P!!H+!0@0000`P!4!(",$$ "$%  P!0 8!   ! ! 0 BD0C PP <8XedPdNdFdd\d]d~d8e4e0eyddd@eTd cXd(e$edzeJdvePe#dJddd` @-000P SDDz@'8Pi404,00S@@eXdddLd\d c,eE-PPC0LS0M00կP ͯP 3įRP Q*jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-dhdhdd'd'd8(Hdޖdddd d0dCdTdfdwdddd—dԗddd dLdvdvd'vd6vd7ldEvdWvdgvdwvdd%dMd)dVdbdmd  @ @    @aa ax)ca aa`apa4`xaa`\cb4a,6bna;c ata\`aa`aa`aaaXaaa$aaaaa`aaaaaa|aaha&`d+`dd1`d 9`d @`dF`dhdM`d `d W`d ^`df`dcq`d`d`d`d`d`d`d`d      !"#$p%p&p'p(")*"+p,p-0.0/00010c ^dcsdPcd\cdc dc d cd 0cd;Zx0NXdmdP\b[bZbidc{dcdcdcIb Jb4HbFbHIbmd bbb< bbfxdexdVTdixd Zxd axd Rxd rxd VxdkxdOcdddddRxdVTdVxdixdZxd^xdaxdexdhxdkxdoxdrxdvxd˕dߕddKbKddddddˑddddddʑdϑdڑd%dddddddd ddd#dhdՃd ރd d d d  d@Edd?Ԁd4dNd id d d d Ԁd߀ddd ۂd d d /d KdgdԀdwdddddddd ?d ?ddidԀd d Ԁd d ,d d9dҁdUdqddidxd d Ԁd d d ddҁddd d d d "d d5d,aaaaCd Nd Yd cd  nd @yd d%2d%5 d%6d%7d d%8Ȓd%:aԒd&d `d%9d#ad( ad&d `&d%:a2d•:`>d%;aId%<aTd a_d ajd$ Aud(d”<d…;d…:d†:d…9“d„<ϓd€;ۓd;d:d„:d€9d9dƒ9(d„95d8Bd„8Od7[d„776db dtdCed9d1dId&Lgd%d|!d(dc]gdjgdpgddvgdgdzgdgdgd gdgdgdgdgdgdgdgdgdgdgdgdgdgdgdgd ydgd hdhd hdhd#hd,hd5hd;hdAhdGhdMhdRhd`hdhhdphdvhdhd hdhd~hdhdhdhdhdKdKdadFadadSadaddad adtadadadadadadadKdKdcfdfdfdhdfdfdfdfdfdfdfdfdfdSedfd(adgdgd%gd-gd1gd5gd=gdLgdPgdKdKd adadqdadfdTgdadadadadF`dbd"bd0bd ObdXbd lbdubd&bdbd%bdbdcbdbdbd bdbdcdcd7cd?cdodMcdTcdacd#cdcdcdcd cdcdcdcddddd(dd2dd@ddMdd`ddhdd|ddddddddddddddddddeded$edCedHedSedWed {eded!eded"eded$edfd''fd-fd(?fdJfd)dfdofdKdKddQdjdKaJa@ndDndHndMndTndZnd^nd/!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.> !1Aa  0@`@@A@!  @a`10  @ #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      u-boot*EHCI Host Controller*print_cpuinfo__of_translate_addressfdt_fixup_memory_banksdo_bootvx_fdtusb_setup_descriptordev_get_parent_privdevice_remove__mvgbe_mdio_readphy_device_create_ehci_create_int_queuefs_devreaddev_get_uclass_priv__mvgbe_mdio_writedev_get_priv__mvgbe_senddev_get_uclass_plat__mvgbe_recvdev_get_parent_platfdt_find_or_add_subnodedev_get_platdevice_probe%s: Bad cell count for %s (((((AAAAAABBBBBB## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands %s: xfers requiring several transactions are not supported. Timeout destroying interrupt endpoint queue DRAM: sysrstdelaysysrstcmdarch_numberTLB addrirq_spsp start bad length %d < %d ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again Hit any key to stop autoboot: %2d  0%2d *?[\Resetting CPU ... %-12s= 0x%0*lx %-12s= 0x%.*llx Unknown operator '%s' ERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available %s read: device %d block # %lu, count %lu ... %ld blocks read: %s write %s write: device %d block # %lu, count %lu ... %ld blocks written: %s ** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** bootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") (none) IDE device %d: Device %d: unknown device changed to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u initcall sequence %p failed at call %p (err=%d) ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) reserved-memoryregno-map## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeWrong Ramdisk Image Format ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image ## Loading init Ramdisk from multi component Legacy Image at %08lx ... (fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s FDT creation failed!/memory## WARNING: fixup memory failed! initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... image is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failedbootdelaykernel-offsetkernaddrrootdisk-offsetrootaddr%s.%sUnknown uclass '%s' in label Unknown seq %d for label '%s' part_%xwhole.bootdevMissing bootstd device boot_targetsExpected at most %d bootdevs, but overflowed with boot_target '%s' Scanning bootdev '%s': No more bootdevs ** Booting bootflow '%s' with %s Boot failed (err=%d) Ramdisk image is corrupt or invalid ERROR: RD image overlaps OS image (OS=0x%lx..0x%lx) Could not find a valid device tree ERROR: FDT image overlaps OS image (OS=0x%lx..0x%lx) Automatic boot of image at addr 0x%08lX ... bootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again bootsecure%*s ## Error: Secure boot command not specified ## Error: "%s" returned (code %d) xtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected %s - %s Usage: %s - No additional help available. Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** ** Unknown image type No closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\%.*sbootcmd=setenv ethact ethernet-controller@72000; ${x_bootcmd_ethernet}; setenv ethact ethernet-controller@76000; ${x_bootcmd_ethernet}; ${x_bootcmd_usb}; ${x_bootcmd_kernel}; setenv bootargs ${x_bootargs} ${x_bootargs_root}; bootm 0x6400000;bootdelay=3baudrate=115200loadaddr=0x800000mtdids=mtdparts=x_bootcmd_ethernet=ping 192.168.2.1x_bootcmd_usb=usb startx_bootcmd_kernel=fatload usb 0 0x6400000 uImagex_bootargs=console=ttyS0,115200x_bootargs_root=root=/dev/sda2 rootdelay=10%s: null device (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Supports 48-bit addressing Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available unbind() method failed on dev '%s' on error path Failed to unbind dev '%s' on error path device '%s' failed to unbind %s: Device '%s' failed to remove on error path %s: Device '%s' failed to remove, but children are gone %s: Device '%s' failed child_post_remove()U-Boot.armbootp_archbootp_vciDHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE Host Name*** WARNING: %s is too long (%d - max: %d) - truncated Root Path*** Unhandled DHCP Option in OFFER/ACK: %d 0123456789ABCDEFEHCI failed: timeout when disabling periodic list , Build: %sextlinux/extlinux.confCore: %d devices, %d uclasses, devicetree: %sVirtual root driver already exists! Virtual root driver does not exist! Some drivers failed to bind bootstdbootstd_drvbootmeth_Some drivers were not found tick-timer(not set)boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit current eth = %s ethaddr%-12s= %s IP addr = %s fdt_blobnew_fdtfdt_sizedevicetree = %s bootcmd## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx Flags not supported: enable CONFIG_BOOTFLOW_FULL Out of memory Trying to execute a command out of order ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... confaddr## Transferring control to Plan 9 (at address %08lx) ... ## Transferring control to RTEMS (at address %08lx) ... filesizeverify## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand failed (err=%d) Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated tftpAutomatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified bootfilehost:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... List of available devices: %-8s %08x %c%c data abort unknown Cannot find RTC: err=%d Reset RTC... ## Failed to set date after RTC reset ## Bad date format ## Set date failed: err=%d ## Get date failed Date: %4d-%02d-%02d (%sday) Time: %2d:%02d:%02d -n## Resetting to default environment edit: setenv## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Warning: Input data exceeds %d bytes - truncated ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d ## %s: only one of "-b", "-c" or "-t" allowed Environment size: %d/%ld bytes ## Error: "%s" not defined usage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** ControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! moNew length 0x%X < existing length 0x%X, aborting. mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value 0x%plibfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size ------------------------------------------------ libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s fast interrupt request Unable to update property %s:%s, err=%s ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX res Reset IDE: ## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrInvalid data width specifier Can't set block device ** No boot file defined ** ** Reading file would overwrite reserved memory ** Failed to load '%s' %llu bytes read in %lu ms (loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... PHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x Base Address: 0x%08lx byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same Zero length ??? crc32FDXHDX100fullhalfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %sactiveeth%d : %s %pM %s not used ping failed; host %s is not alive host %s is alive prefetch abort The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data resetting ... stop ** Abort software interrupt ## Executing script at %08lx erasemallocReadWrittenprobeFailed to initialize SPI flash at %u:%u (error %d) No SPI flash selected. Please run `sf probe' updateERROR: attempting %s past flash size (%#x) ERROR: flash area is locked Updating, %zu%% %lu B/sSPI flash failed in %s step %zu bytes written, %zu bytes skipped in %ld.%lds, speed %ld B/s SF: %zu bytes @ %#x %s: ERROR %d SF: %zu bytes @ %#x Erased: protectstart sector is not a valid number len is not a valid number unlockundefined instruction starting USB... resetting USB... serialstopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. storgcc (Debian 12.2.0-14) 12.2.0 GNU ld (GNU Binutils for Debian) 2.40 nc%2u %2u-%2u = %5u %sEHCI fail timeout STS_ASS reset marvell,armada-3700-ehcimarvell,ac5-ehciEHCI fail to reset USB EHCI %x.%02x EHCI failed to shut down host controller. unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI fail timeout STS_IAA set EHCI timed out on TD - token=%#x port(%d) reset error Timeout poll on interrupt endpoint out of buffer pointers (%zu bytes left) RE is too long (code overflow)EHCI failed: timeout when enabling periodic list .callbacks${...}${.flags## Warning: Unknown environment variable access method '%c' ## Warning: Unknown environment variable type '%c' ## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" arocsdxbimautostartbootm_lowbootm_mapsizebootm_sizeenv_buf [%u bytes] too small for value of "%s" bad CRCCannot import environment: errno = %d import failedLoading Environment from %s... %s=%s ## Error: cannot export environment not initialized Failed (%d) Saving Environment to %s... not possible *** Warning - %s, using default environment malloc() failedspi_flash_read() failedErasing SPI flash...Writing to SPI flash... %s%daddr%saddr%pM%s.%dunknownethactethrotatenoethprimeeth%d: %s [PRIME]eth%dmacskipethmacskip Error: eth device name "%s" has a space! eth_bootdevDT Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Warning: %s (eth%d) using random MAC address - %pM Error: %s address %pM illegal value Warning: %s failed to set MAC address ** File not found %s ** Failed to iterate over directory %s < ? > %10u %s ** Can not find directory. ** Error: FAT sector size mismatch (fs=%hu, dev=%lu) Error: FAT cluster size not set Error: FAT cluster size too big (cs=%u, max=%u) ** Unable to read file %s ** U%02X%02X-%02X%02X#address-cellsfdt_chosen: %s WARNING: could not set bootargs %s. 2023.01+dfsg-2+deb12u1u-boot,versionWARNING: could not set u-boot,version %s. ERROR: - must RESET the board to recover. %s: %s: %s /aliasesetherneteth%daddrlocal-mac-address%s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. linux,phandlefdt_initrd: %s linux,initrd-startlinux,initrd-endWARNING: could not set linux,initrd-start %s. WARNING: could not set linux,initrd-end %s. fdt_root: %s serial#serial-numberWARNING: could not set serial-number %s. #size-cellsrangesThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dokayNo valid device tree binary found at %p No current device Interface: %s No valid FAT fs found Filesystem: %s "%s" Invalid FAT entry Error reading cluster => Jump offset is too bigoutbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02xmissing environment variable: %s ** Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block * %s read error - last part %s/ %s %8lld %s %d file(s), %d dir(s) Unknown ArchitectureUnknown CompressionUnknown OSUnknown Image%d Bytes = %4d-%02d-%02d %2d:%02d:%02d UTC %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done Cannot find console unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) Error: Invalid FAT entry: 0x%08x %uBase path too long (%s%s) Retrieving file: %s Could not initialize timer (err %d) Could not read count from timer (err %d) Error: Bad gzipped data Error: gunzip out of data in header Expected include path: %.*s Couldn't retrieve %s pxe_label_overrideMissing override pxe label: %s Missing default: %s ### ERROR ### Please RESET the board ### CRC32 for %08lx ... %08lx ==> %08lx 0123456789abcdef %0*lxEnv export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! Bus %d: ** Timeout ** not available OK blk#%dide_blkNo Powersaving mode %X IDE read: device %d not ready Error (no IRQ) dev %d blk %lx: status %#02x XIP %s %s Loading Uncompressing %s Unimplemented compression type %d ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC Unknown image format! %sImage Name: %.*s %sCreated: %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x ERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconf - must RESET the board to recover. Bad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command unknown compression methodincorrect header checkunknown header flags setinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkinvalid distance too far backinvalid distance codeinvalid literal/length codebaudrateload-environmentNet: %s=%s%d.%d.%d.%d.dtb./bootmlocalcmdNo kernel given, skipping %s ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxkernel_addr_rSkipping %s for failure retrieving kernel ipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s malloc fail (FIT address) fdt_addr_rfdtfilesocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT fdt_addrfdtcontroladdr%s: %s No match for driver '%s' compatibleDevice tree error at node '%s' Error binding driver '%s': %d ERROR: Failed to allocate 0x%lx bytes below 0x%lx. lmb_dump_all: %s.cnt = 0x%lx %s[%d] [0x%llx-0x%llx], 0x%08llx bytes flags: %x Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes %s ## Total Size = 0x%08x = %d Bytes probe [[bus:]cs] [hz] [mode] - init flash device on given SPI bus and chip select sf read addr offset|partition len - read `len' bytes starting at `offset' or from start of mtd `partition'to memory at `addr' sf write addr offset|partition len - write `len' bytes from memory at `addr' to flash at `offset' or to start of mtd `partition' sf erase offset|partition [+]len - erase `len' bytes from `offset' or from start of mtd `partition' `+len' round up `len' to block size sf update addr offset|partition len - erase and write `len' bytes from memory at `addr' to flash at `offset' or to start of mtd `partition' sf protect lock/unlock sector len - protect/unprotect 'len' bytes starting at address 'sector'Waiting for PHY realtime link%s %s: Macronix Quad bit not set prebootNo CLI availablemarvell,reg-initunknown cmd (%d) at %d ## ERROR: unsupported match method: 0x%02x Cannot add window '%04x:%04x', conflicts with another window %s: %x - %s <--> %s %s is not a known ethernet mdio_register: non unique device name '%s' Enter choice: %s not found PHY duplexPHY AN duplexPHY AN adv duplex read failed, assuming half duplex NULL device name! MII devices: '%s' Current device: '%s' No such device: %s PHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T %08lx: %08x %0lx %04x %02x ? mtdparts support missing. Offset exceeds device limit '%s' is not a number Size exceeds partition or device limit device %d whole chip offset 0x%llx, size 0x%llx We only support <64K transfers for now Failed to wait for completion on port %d ATA operation timed out Error: RTC in 12 hour mode, can't determine AM/PM. Error: RTC did not increment. Warning: Only century %d supported. *** spi_xfer: Time out during SPI transfer marvell,kirkwood-eth-portfixed-linkfull-duplexFailed to allocate MDIO bus Err..(%s) Dropping packet spread on multiple descriptors Err..(%s) Dropping packet with errors Non-aligned data too large (%d) Err..(%s) in xmit packet phy_connect failed EPTGMKautoloadNFSCannot autoload with NFS Cannot autoload with TFTPGET *** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Abort Bytes transferred = %d (%x hex) ICMP Host Redirect to %pI4 netretryyesoncerootpathdnsipdomain*** ERROR: Cannot mount done *** ERROR: File lookup fail *** ERROR: Symlink fail *** ERROR: NFS version not supported /nfsroot/%02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' Using %s device File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: * Retry count exceeded; starting again T /configu-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplphy-modephy-connection-type## Baudrate %d bps not supported ## Baudrate may not be deleted \.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,bootmeths:bootmeths,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,serial#:serialno,stdinstdoutstderreth\d*addr:ma,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,Expected string: %.*s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s Expected string literal: %.*s IFS\$'";&|#;$&|exit not allowed from main input shell. %s:%dblk_partitionCould not find "%s" partition Couldn't find partition %s %s ** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x ** First descriptor is NOT a primary desc on %d:%d ** CD001** Wrong ISO Ident: %s on %d:%d ** EL TORITO SPECIFICATION** No valid boot catalog found on %d:%d ** ** Wrong El Torito ident: %s on %d:%d ** ** Can't read Boot Entry at %lX on %d:%d ** ** Checksum Error in booting catalog validation entry on %d:%d ** ** Key 0x55 0xAA error on %d:%d ** ** Partition %d not found on device %d ** ** Partition %d is not bootable on device %d ** Whole Disk## Unknown partition table type %x Partition Map for IDESATAUSBMMCHOSTNVMePV BLOCKVirtIOEFIUNKNOWN device %d -- Partition Type: %s Part Start Sector Num Sectors UUID Type ** No boot partition found on device %d ** Part Start Sect x Size Type %2d %8lu %8lu %6ld %.32s hdusbdmmcsdxx%s%c%dCould not get PHY for %s: addr %d %s:%d is connected to %s. Reconnecting to %s (null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed PHY reset timed out A1A0Z0Error.. %s:Unsupported Kirkwood SoC 88F%04x SoC: Kirkwood 88F%04x_%s fdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%s%llu Hz%s%lu.%ld %cHz%s Boot Extd%3d %-10lu %-10lu %08x-%02x %02x%s%s %u Bytes%s %ciB%sError parsing config file invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** FAT32 FAT12 FAT16 ncipncoutportncinport^%s$Error compiling regex: %s HUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command nr-portssata_mv_blkUnable to allocate memory for request queue Unable to allocate memory for response queue SATA%dFailed to malloc id data Err: Failed to identify SATA device %d Device error on port: %d Device not ready on port: %d Cannot probe SATA device %d (err=%d) No SATA device found! Cannot scan SATA device %d (err=%d) Cannot find SATA device %d (err=%d) Cannot remove SATA device '%s' (err=%d) %s: readonly variableWorking FDT set to %lx fdtaddrspi_flash_probe_bus_cs() failed (effective reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: (%0*x) %0*x Err..(%s) Invalid PHY address %d Err..(%s) Invalid register offset %d Err..(%s) SMI read ready timeout Err..(%s) Invalid phy address Err..(%s) Invalid register offset Error: SMI busy timeout %s %s: Invalid cs %d (err=%d) spi_flash@%d:%djedec_spi_norSF: Failed to set up slave Invalid bus %d (err=%d) %s %s: Invalid chip select %d:%d (err=%d) !R\248>Ž ; - set max blocks per entry and max cache entries showconfigureconinfoprint console devices and informationget/set/reset date & time[MMDDhhmm[[CC]YY][.ss]] date reset - without arguments: print date & time - with numeric argument: set the system date & time - with 'reset' argument: reset the RTCSunMonTuesWednesThursFriSaturecho args to console[-n] [args..] - echo args to console; -n suppresses newlinebootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s)exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsfatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizeflattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structdiskbootboot from IDE deviceloadAddr dev:partIDE sub-systemreset - reset IDE controller ide info - show available IDE devices ide device [dev] - show or set current device ide part [dev] - print partition table of one or all IDE devices ide read addr blk# cnt ide write addr blk# cnt - read/write `cnt' blocks starting at block `blk#' to/from memory address `addr'itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<=load binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'halfworddouble wordrandomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data loopinfinite loop on address range[.b, .w, .l, .q] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l, .q] addr1 addr2 countmemory copy[.b, .w, .l, .q] source target countmwmemory write (fill)[.b, .w, .l, .q] address value [count]nmmemory modify (constant address)[.b, .w, .l, .q] addressmmmemory modify (auto-incrementing address)memory display[.b, .w, .l, .q] address [# of objects]MII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablemdioMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)NET sub-systemlist - list available devices listpingsend ICMP ECHO_REQUEST to network hostpingAddressnfsboot image via network using NFS protocol[loadAddress] [[hostIPaddr:]bootfilename]dhcpboot image via network using DHCP/TFTP protocoltftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocolSATA sub systeminit - init SATA sub system sata stop [dev] - disable SATA sub system or device sata info - show available SATA devices sata device [dev] - show or set current device sata part [dev] - print partition table sata read addr blk# cnt sata write addr blk# cntsfSPI flash sub-systemtruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-a-z-e1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'imxtractextract a part of a multi-imagerunrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintsaveexistssaveenvsave environment variables to persistent storageshowvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildodoneusb_hubusb-hubusb_mass_storageusb-mass-storageBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access fileDOSISOscsinvmeefiloadervirtiopvblock/clocks/firmwarerootroot_drivernopsimple_bussimple-bussimple-mfdphy-handlephy-devicesgmii-2500qsgmiirmiirgmiirgmii-idrgmii-rxidrgmii-txidrtbi1000base-x2500base-xrxauisfiinternal25g-auixlaui4caui2caui4NC-SI10gbase-rusxgmiispi_flashjedec,spi-normx25l2005amx25l4005amx25l8005mx25l1606emx25l3205dmx25l6405dmx25u2033emx25u1635emx25u3235fmx25u6435fmx25l12805dmx25u12835fmx25u51245gmx25l12855emx25l25635emx25u25635fmx25v8035fmx25r1635fmx25l25655emx66l51235lmx66u51235fmx25u51245fmx66u1g45gmx66u2g45gmx66l1g45gmx66l2g45gmx25l1633emx25r6435fmx66uw2g345gx0mx66lm1g45gmx25lm51245gmx25lw51245gmx25lm25645gmx66uw2g345gmx66um1g45gmx66uw1g45gmx25uw51245gmx25uw51345gmx25um25645gmx25uw25645gmx25um25345gmx25uw25345gmx25uw12845gmx25uw12345gmx25uw6445gmx25uw6345gmvgbemarvell,kirkwood-ethGeneric PHYMarvell 88E1680Marvell 88E1310Marvell 88E151xMarvell 88E1240Marvell 88E1149SMarvell 88E1145Marvell 88E1121RMarvell 88E1118RMarvell 88E1118Marvell 88E1111SMarvell 88E1011Sspi_generic_drvspi_genericmvebu_spimarvell,orion-spimarvell,armada-375-spimarvell,armada-380-spimarvell,armada-xp-spiorion_timermarvell,orion-timermarvell,armada-370-timermarvell,armada-xp-timersata_blksata_mv_ahcimarvell,armada-370-satamarvell,orion-satartc-mvmarvell,kirkwood-rtcmarvell,orion-rtcusb_dev_genericu-boot,bootdev-usbehci_mvebumarvell,orion-ehciSPIFlashfatext4unsupportedFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGSseparatefitembednvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcsnps,dwc2intel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspallwinner,sun4i-a10-nandaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-initu-boot,bootdev-ethnvlansyntax error FATFAT32blksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... TFTP error: '%s' (%d) Not retrying... octetblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedtftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) fromTFTP %s server %pI4; our IP address is %pI4Filename '%s'.Load address: 0x%lx Retry count exceeded %s; starting again clock-frequencyHUSH_VERSION0.01( w usb,device-classusb,interface-classHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk onlySelf Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dms%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d String: "%s"Error: Cannot find high speed parent of usb-1 device See InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudiounable to get descriptor, error %lX config descriptor too short (expected %i, got %i) usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times cannot reset port %i!? Bus %s: Port not available. probe failed, error %d No working controllers found lun%dusb_storage_blkusb_bootdevscanning bus %s for devices... No USB Device found %d USB Device(s) found generic_bus_%x_dev_%xusb_dev_generic_drvusb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX selecting invalid interface %d%s: invalid max packet size Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) 12 Mb/s+- %s (%s, %dmA) %s %s %s %s Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. ## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx U-Boot 2023.01+dfsg-2+deb12u1 (Apr 18 2024 - 22:00:21 +0000) Marvell-DreamPlugERROR : xmalloc failed ERROR : xrealloc failed Unknown errorloadxy_timeout1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d dZ`\`P[`W`lZ`[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image When booting a Linux kernel which requires a flat device-tree a third argument is required which is the address of the device-tree blob. To boot that kernel without an initrd image, use a '-' for the second argument. If you do not pass a third a bd_info struct will be passed instead Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image ramdisk - relocate initrd, set env initrd_start/initrd_end fdt - relocate flat device tree cmdline - OS specific command line processing/setup bdt - OS specific bd_info processing prep - OS specific prep before relocation or go go - start OS d8aKdKd3kd8aKdKd7cd8aKdKdc8a KdKd:kd8a@KdKdBkd8aKdKdFkd8aKdKdKkd8aKdKd\id8aKdKdSld8ak`KdKdscan - boot first available bootflow [addr] - run script starting at addr - A valid image header must be present>mdXadq`KdKdCmdXap`KdKd /addr [-c] [-q] [] - Set the [control] fdt location to fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.@dždXa`KdKdaddr part [dest] - extract from legacy image at and copy to default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] 1`dXa `KdKd&d Xa`KdKd-dXa`KdKd2dXa,`KdKd9dXaL`KdKd@d 8a`KdKdd 8aȂaKdKdFdXaH`KdKd8cUa8ZdHc=d`6bg)ddc=d|chd8C` >dܔcdc=d cdcd ,b@bܚbda aa d@aaad$d!d0da*d8I`N` hd^ d\a/d'cLccHc6d7SdG]OdM`Bdid`\aWdda dh\a:bdcd,c `$`(`,`0`4`8`````````x`|``,`0` ` ` ` `d ` ````` `$`(`,`0`4`8`<`@`D`H`L`x````(`T``````````` `(`0````(````$`(`,`0`4`8`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`#`#`#` #`#`#`#`$`$`$`%`%`%` %`%`%`%`%`%`&`&`&`h'`'`'`P(`(`p)`t)`x)`*`,`\,`,`X-`\-``-`3`3`3`3`3`3`3`3`3`3`3`3`3`3`3`3`3`3`3`3`3`3`3`3`3`4`4`4` 4`4`4`4`4`4`4`6`6`6`6`6`6`6`6`6`6`6`6`6`6`6`6`6`6`6`6`6`6`8`8`8`8`8`8`8`8`8`9`9`9` 9`9`9`9`9` 9`$9`9`9`9`9`9`9`\<``<`d<`h<`l<`,=`=`|?`?`?`?`?`?`@`@`@`@`@`@`@`C` C`C`C`C`C` C`$C`(C`,C`0C`4C`dC`C`C`C`,D`XD`F`F`F`F`F`F`F`F`F`F`H` H`H`H`H`H`H`HJ`K`K`K`K`|L`L`L`PN`TN`XN`\N`P`P`P`P`P`Q`Q`lT`pT`V`V`X`LZ`PZ`TZ`XZ`\Z``Z`Z`L[`\`@\`D\`]`]`]`^`^````` ``$``(``,``0``4``b`b`b`b`b`b`b`b`c`c`c` c`c`c`c`c`d`d`d`d`d`d`,e`0e`bx>b|>b>b@b@b@b@b\Ab`AbdAbhAblAbpAbtAbxAbAbAbAbAbAbAbAbAb BbBbBbBb Bb$Bb(Bb,Bb0Bb4Bb8Bb|BbBbBbBbBbBbBbBbIb`JbKb@UbDUbHUbLUbPUbTUb\UbxUb|UbUbUbXbXbXb[bH\b,]b]b]b_bxbbebebebebebebfb fbfbfbgbgbgbgbgbgbibkbkb@lbmbmbqbqbhrbxbxbxbxbxbxb~b~b~b~bbbbbbbbbbbbbbbbhbb bLbbbbbb,b0bbbbb bbbbbLbPbTbXb\b`bbċbȋbXb\bbbbbbbbbbbHbLbPbTbbbbb bbbbbbbhblbpbtbxb|bbbbbbbb0b4b8b|bbbb$bbbbbc>c>c>c@cAcAc